Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ypjA (ypjA)

This Recombinant Bacillus subtilis Uncharacterized protein ypjA (ypjA) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

Uncharacterized protein ypjA

UniProt

P54392

Expression Region

1-185

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLILVLAINFLGTVYGYYWYLPQLLETPARFLIFVPDSPTATFFFLFVLLAFLMKRNAPL LEALALVTLVKYGLWAVAMNFLVLAVTGDLPWEGYMLIASHFAMAVQGVLYSPYFRFSFW HLAIAAVWTLHNDVIDYLFDMMPQYSMLSDYMTEIGYGTFWLSIFSIALAYFLVVSKKQT KLELM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAZ1 Human Gene Knockout Kit (CRISPR)
KN421488 1 Kit

DAZ1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ADCY8 (NM_001115) Human Over-expression Lysate
E45H05572-2 20 µg

ADCY8 (NM_001115) Human Over-expression Lysate

Sign In for Pricing
View Details
CLDN22 Protein Vector (Rat) (pPB-N-His)
PV260319 500 ng

CLDN22 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
MOCS1 Rabbit pAb, PerCP-Cy7 conjugated
orb2825195 100 µL

MOCS1 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
DEPDC7 (NM_001077242) Human Tagged Lenti ORF Clone
RC205910L3 10 µg

DEPDC7 (NM_001077242) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GSK3 beta antibody
20R-2124 50 ug

GSK3 beta antibody

Sign In for Pricing
View Details