Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ypjA (ypjA)

This Recombinant Bacillus subtilis Uncharacterized protein ypjA (ypjA) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

Uncharacterized protein ypjA

UniProt

P54392

Expression Region

1-185

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLILVLAINFLGTVYGYYWYLPQLLETPARFLIFVPDSPTATFFFLFVLLAFLMKRNAPL LEALALVTLVKYGLWAVAMNFLVLAVTGDLPWEGYMLIASHFAMAVQGVLYSPYFRFSFW HLAIAAVWTLHNDVIDYLFDMMPQYSMLSDYMTEIGYGTFWLSIFSIALAYFLVVSKKQT KLELM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP1LC3B (Microtubule-Associated Protein 1 Light Chain 3 beta, LC3B, MAP1A/1BLC3) (MaxLight 550)
248429-ML550 100 µL

MAP1LC3B (Microtubule-Associated Protein 1 Light Chain 3 beta, LC3B, MAP1A/1BLC3) (MaxLight 550)

Sign In for Pricing
View Details
FMO8P siRNA Oligos set (Human)
20700171 3x 5 nmol

FMO8P siRNA Oligos set (Human)

Sign In for Pricing
View Details
Anti-STAC antibody
STJ191402 200 µl

Anti-STAC antibody

Sign In for Pricing
View Details
PF-04217903 phenolsulfonate
orb1708895-01 25 mg

PF-04217903 phenolsulfonate

Sign In for Pricing
View Details
PF-04217903 phenolsulfonate
orb1708895-02 100 mg

PF-04217903 phenolsulfonate

Sign In for Pricing
View Details
PF-04217903 phenolsulfonate
orb1708895-03 50 mg

PF-04217903 phenolsulfonate

Sign In for Pricing
View Details