Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ypjA (ypjA)

This Recombinant Bacillus subtilis Uncharacterized protein ypjA (ypjA) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

Uncharacterized protein ypjA

UniProt

P54392

Expression Region

1-185

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLILVLAINFLGTVYGYYWYLPQLLETPARFLIFVPDSPTATFFFLFVLLAFLMKRNAPL LEALALVTLVKYGLWAVAMNFLVLAVTGDLPWEGYMLIASHFAMAVQGVLYSPYFRFSFW HLAIAAVWTLHNDVIDYLFDMMPQYSMLSDYMTEIGYGTFWLSIFSIALAYFLVVSKKQT KLELM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDF7 Antibody
E38PA5577 100 µL

GDF7 Antibody

Sign In for Pricing
View Details
StemXVivo Mesoderm Kit
SC030B 1 Kit

StemXVivo Mesoderm Kit

Sign In for Pricing
View Details
Anti-Superoxide Dismutase 4/CCS Antibody Picoband® (Dylight488 Conjugate)
A00314-1-Dylight488 100 µg

Anti-Superoxide Dismutase 4/CCS Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
CaMKII-IN-1 50mg
A21034-50 50 mg

CaMKII-IN-1 50mg

Sign In for Pricing
View Details
Exonuclease V / EXO5 / DEM1
F54546-0.4ML 0.4 mL

Exonuclease V / EXO5 / DEM1

Sign In for Pricing
View Details
CPAMD8 Protein Vector (Human) (pPB-C-His)
PV070669 500 ng

CPAMD8 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details