Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

A3PDZ6

Expression Region

1-185

Origin

Prochlorococcus marinus (strain MIT 9301)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSDLKSFDKIEQKIGGSRKISNYIIGGMLTIGGIGFLLASISSYTGRDLLPLGNPSTLL FIPQGIIMGAYGVIANLLNFYLWYLVYINFGSGSNYFDKSSKSIEIRRKGLFKDIEVKLN FDEIKSVKLDISEGFNPRRRIALVLKGRKKPLPLSGAGELKPLLQVEEEGARLAKFLDVN LEGLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Podophyllotoxin 4-O-Glucoside
TRC-P681010-5MG 5 mg

Podophyllotoxin 4-O-Glucoside

Sign In for Pricing
View Details
Rrh Mouse Gene Knockout Kit (CRISPR)
KN515137 1 Kit

Rrh Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human FLNC protein (His tag)
PDEH100853-01 20 µg

Recombinant Human FLNC protein (His tag)

Sign In for Pricing
View Details
Recombinant Human FLNC protein (His tag)
PDEH100853-02 100 µg

Recombinant Human FLNC protein (His tag)

Sign In for Pricing
View Details
Recombinant Human FLNC protein (His tag)
PDEH100853-03 500 µg

Recombinant Human FLNC protein (His tag)

Sign In for Pricing
View Details
Recombinant Human FLNC protein (His tag)
PDEH100853-04 1 mg

Recombinant Human FLNC protein (His tag)

Sign In for Pricing
View Details