Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida Potassium-transporting ATPase C chain (kdpC)

This Recombinant Pseudomonas putida Potassium-transporting ATPase C chain (kdpC) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

Potassium-transporting ATPase C chain, EC= 3.6.3.12, ATP phosphohydrolase [potassium-transporting] C chain, Potassium-binding and translocating subunit C, Potassium-translocating ATPase C chain

UniProt

A5W155

Expression Region

1-185

Origin

Pseudomonas putida (strain F1 / ATCC 700007)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAYLRPALSLALLMTLVTGALYPLAVTGIAQVAFPNQANGSLVRDAQGQVRGSALIAQD FQGDGWFHSRPSAGAYATVASGASNLSPSNPALAERVKGDAATLYQAQQGPVPQALLTTS GSGLDPHLPPEALAYQIPRVAAARQLPVERLQALLEQATLHPLIGPPVVNVLALNQALEK LAIVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPC150 (UBE2T) Rabbit Polyclonal Antibody
TA365465 100 µL

HSPC150 (UBE2T) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MEGF6 (NM_001409) Human Recombinant Protein
TP313157M 100 µg

MEGF6 (NM_001409) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Fgf1 activation kit by CRISPRa
GA201391 1 Kit

Mouse Fgf1 activation kit by CRISPRa

Sign In for Pricing
View Details
Beta-Naphthylcarbinol
TRC-N345645-5G 5 g

Beta-Naphthylcarbinol

Sign In for Pricing
View Details
FXYD4 (NM_173160) Human Recombinant Protein
TP308892L 1 mg

FXYD4 (NM_173160) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human NLGN4X Protein (His Tag)
PKSH032797-01 10 µg

Recombinant Human NLGN4X Protein (His Tag)

Sign In for Pricing
View Details