Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

A8G5U6

Expression Region

1-185

Origin

Prochlorococcus marinus (strain MIT 9215)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSDLTSFDKIEQKIDGSRKISNYIIGGMLTIGGIGFLLASISSYTGRDLLPLGNPSALL FIPQGIIMGAYGVIANLLNFYLWYMVYINFGSGSNSFDKSSKSVEIKRKGLFKDIEVRLD FDEIKSVKLDISEGFNPRRRIALVIKGRKKPLPISGAGELKPLLQVEEEGARLAKFLNVN LEGLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRA10AC1 Rabbit Polyclonal Antibody (BF405)
orb2373308 100 µL

FRA10AC1 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Human Cyclin D2 (CCND2) ELISA Kit
MBS456031-01 48 Tests

Human Cyclin D2 (CCND2) ELISA Kit

Sign In for Pricing
View Details
Human Cyclin D2 (CCND2) ELISA Kit
MBS456031-02 96 Tests

Human Cyclin D2 (CCND2) ELISA Kit

Sign In for Pricing
View Details
Human Cyclin D2 (CCND2) ELISA Kit
MBS456031-03 5x 96 Tests

Human Cyclin D2 (CCND2) ELISA Kit

Sign In for Pricing
View Details
Human Cyclin D2 (CCND2) ELISA Kit
MBS456031-04 10x 96 Tests

Human Cyclin D2 (CCND2) ELISA Kit

Sign In for Pricing
View Details
Complement C3 discontinued
C7850-10B 50 µg

Complement C3 discontinued

Sign In for Pricing
View Details