Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodopseudomonas palustris ATP synthase subunit b' (atpG)

This Recombinant Rhodopseudomonas palustris ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'

UniProt

B3QF35

Expression Region

1-185

Origin

Rhodopseudomonas palustris (strain TIE-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQGHGDAKGTTAHTEAGGGHKAPFPPFQQETFASQLVSLAIAFVALYLIVSKIALPRVG GVIEERQKTIDGDLAAAQKLKGEADDALKAYEAELADARARAQAIGAETREKLNAQAEAE RKTLEQRLAAKLADAEKTIATTRTAAMGNVRNIASDAASAIVQQLAGVTPDSKAVDSAVD ASLKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-100 1x 100 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF405S conjugate, 0.1mg/mL
BNC040324-100 1x 100 µL

CD53 (161-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXA1 / HNF3A (rFOXA1/1515), CF488A conjugate, 0.1mg/mL
BNC882305-500 1x 500 µL

FOXA1 / HNF3A (rFOXA1/1515), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (GROEL/730), CF740 conjugate, 0.1mg/mL
BNC740730-500 1x 500 µL

HSP60 (GROEL/730), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (PTPRC/818), CF594 conjugate, 0.1mg/mL
BNC940818-100 1x 100 µL

CD45RA (PTPRC/818), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (TGB/1968R), CF594 conjugate, 0.1mg/mL
BNC941968-500 1x 500 µL

Thyroglobulin (Thyroidal Cell Marker) (TGB/1968R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details