Recombinant Welwitschia mirabilis Photosystem I assembly protein Ycf4 (ycf4)
This Recombinant Welwitschia mirabilis Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-185.
Product Specifications
Product Name Alternative
Photosystem I assembly protein Ycf4
UniProt
B2Y1X0
Expression Region
1-185
Origin
Welwitschia mirabilis (Tree tumbo) (Welwitschia bainesii)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNNQSKRLWIEPIQGSRRKSNFFFASILFGGALGFFLVGFSSYLGRNLLPLLSSQQIIFV PQGIVMCFYGIAGLFFSSYLWCTIFFNVGSGYNQIDEKTGIVCLFRWGFPGRNRRIFLRF PLKNVHMIKMEVQENLFSSRHILYMKVKGLPDIPLARTGENLNLKEMEQKAAELARFLHV SIEGF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400034-500 1x 500 µL
Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471820-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040276-500 1x 500 µL
TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details