Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vitis vinifera ATP synthase subunit b, chloroplastic (atpF)

This Recombinant Vitis vinifera ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

Q0ZJ34

Expression Region

1-185

Origin

Vitis vinifera (Grape)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNVTDSFVSLGHWPSAGGFGFNTDILATNPINLSVVLGVLIFFGKGVLSDLLDNRKQRI LNTIRNSEELREGAIEQLEKARARLRKVEMEADQYRVNGYSEIEREKLNLINSTYNTLEQ LENYKNETIHFEQQRAINQVRQRVLQQALQGALGTINSCLNKELHLRTISANIGMFGSMK EIRNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trichlorfon (>90%)
TRC-T773855-25G 25 g

Trichlorfon (>90%)

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD274/PD-L1 Antibody[29E.2A3]
E-AB-F1133H-01 20 Tests

PE/Cyanine7 Anti-Human CD274/PD-L1 Antibody[29E.2A3]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD274/PD-L1 Antibody[29E.2A3]
E-AB-F1133H-02 100 Tests

PE/Cyanine7 Anti-Human CD274/PD-L1 Antibody[29E.2A3]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD274/PD-L1 Antibody[29E.2A3]
E-AB-F1133H-03 2x 100 Tests

PE/Cyanine7 Anti-Human CD274/PD-L1 Antibody[29E.2A3]

Sign In for Pricing
View Details
MSH6 (DNA Mismatch Repair Protein) (MSH6/3086), CF405S conjugate, 0.1mg/mL
BNC043086-100 1x 100 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/3086), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS621761 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details