Recombinant Rhodopseudomonas palustris ATP synthase subunit b' (atpG)
This Recombinant Rhodopseudomonas palustris ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-185.
Product Specifications
Product Name Alternative
ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'
UniProt
Q13CX3
Expression Region
1-185
Origin
Rhodopseudomonas palustris (strain BisB5)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAEGHGDAKGATAHTAADGGHKAPFPPFQKETFASQLVSLTIAFVALYLIVSKIILPRVG GVIEERQKTIEGDLAAAQKLKGESDDALKAYEAELAQARSRAQAIGAETREKLNAAAEAE RKTLEQRLAAKIADAEKTISATRTAAMGNVRGIASEAAAAIVQQLAGIQPDSKALDSAVN ASIKG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC140017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681707-100 1x 100 µL
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882305-500 1x 500 µL
FOXA1 / HNF3A (rFOXA1/1515), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details