Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max ATP synthase subunit b, chloroplastic (atpF)

This Recombinant Glycine max ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

Q2PMS9

Expression Region

1-185

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNITDSFLCLGYWPSAGSFGFNTDILATNPINLSVVLGVLVFFGKGVLSDLLDNRKQKI LRTIRNSEELREGAIEQLEKAQARLRKVETEADRFRVNGYSEIEREKLNLINSIYTTLEQ LENYKNEAIHFEQQRVINQVRQRVLQQALQGALGTLKSCLNNELHLRTVSANIGMFGTMK EKITD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL
BNC941035-100 1x 100 µL

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF740 conjugate, 0.1mg/mL
BNC741045-100 1x 100 µL

CD16 (C16/1045), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
BNC401073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF640R conjugate, 0.1mg/mL
BNC400851-500 1x 500 µL

HSP60 (LK1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF488A conjugate, 0.1mg/mL
BNC880871-500 1x 500 µL

CD71 (66IG10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details