Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

Q319Y1

Expression Region

1-185

Origin

Prochlorococcus marinus (strain MIT 9312)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSDLTSFDKIEQKIGGSRKTSNYIIGGMLTIGGIGFLLASISSYTGKDLLPLGNPSTLL FIPQGIIMGAYGVVANLLNFYLWYMVYINFGSGSNSFNKSSKSVEIKRKGLFKDIDVKLN FDEIKSVKLDISEGFNPRRRIALVLKGRKKPLPLSGAGELKPLLQVEEEGARLAKFLNVN LEGLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diethyl 1,1-Cyclobutanedicarboxylate
TRC-D444170-5G 5 g

Diethyl 1,1-Cyclobutanedicarboxylate

Sign In for Pricing
View Details
Ataxin 1 (ATXN1) (NM_000332) Human Recombinant Protein
TP322862L 1 mg

Ataxin 1 (ATXN1) (NM_000332) Human Recombinant Protein

Sign In for Pricing
View Details
Blood Group Antigen B (CD173) (HEB-20), CF740 conjugate, 0.1mg/mL
BNC740296-500 1x 500 µL

Blood Group Antigen B (CD173) (HEB-20), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(E)-3-Bromoacrylic Acid
TRC-B679400-500MG 500 mg

(E)-3-Bromoacrylic Acid

Sign In for Pricing
View Details
Zfx Mouse Gene Knockout Kit (CRISPR)
KN520064 1 Kit

Zfx Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD19 Recombinant Rabbit monoclonal Antibody
HA723533 100 µL

CD19 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details