Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

Q319Y1

Expression Region

1-185

Origin

Prochlorococcus marinus (strain MIT 9312)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSDLTSFDKIEQKIGGSRKTSNYIIGGMLTIGGIGFLLASISSYTGKDLLPLGNPSTLL FIPQGIIMGAYGVVANLLNFYLWYMVYINFGSGSNSFNKSSKSVEIKRKGLFKDIDVKLN FDEIKSVKLDISEGFNPRRRIALVLKGRKKPLPLSGAGELKPLLQVEEEGARLAKFLNVN LEGLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cnot8 Mouse Gene Knockout Kit (CRISPR)
KN503566 1 Kit

Cnot8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (TGB/1968R), 1mg/mL
BNUM1968-50 1x 50 µL

Thyroglobulin (Thyroidal Cell Marker) (TGB/1968R), 1mg/mL

Sign In for Pricing
View Details
9-Phenanthrol-D8
TRC-P295022-5MG 5 mg

9-Phenanthrol-D8

Sign In for Pricing
View Details
HBZ Polyclonal Antibody
E-AB-19122-01 20 µL

HBZ Polyclonal Antibody

Sign In for Pricing
View Details
HBZ Polyclonal Antibody
E-AB-19122-02 60 µL

HBZ Polyclonal Antibody

Sign In for Pricing
View Details
HBZ Polyclonal Antibody
E-AB-19122-03 120 µL

HBZ Polyclonal Antibody

Sign In for Pricing
View Details