Recombinant Yarrowia lipolytica Mitochondrial import inner membrane translocase subunit TIM22 (TIM22)
This Recombinant Yarrowia lipolytica Mitochondrial import inner membrane translocase subunit TIM22 (TIM22) spans the amino acid sequence from region 1-185.
Product Specifications
Product Name Alternative
Mitochondrial import inner membrane translocase subunit TIM22
UniProt
Q6BZY4
Expression Region
1-185
Origin
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSAFGFPGGGAPTPPQGSFWDMTPEQQGMYSANLIMGTMQSCPGKSVMAGVTGFGLGGVF GLFMASMAYDAPVGMGVQTMSDLPFKQQMKIQFTDMGKRAWSSAKNFGFIGGVFSGTECC IESLRAKNDIWNGVAAGCLTGGGLAVKAGPQAALVGCAGFAAFSAAIDVYMRSDNKAPPS TDEDL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740043-100 1x 100 µL
P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402848-500 1x 500 µL
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040096-100 1x 100 µL
Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471627-500 1x 500 µL
CD79a (B-Cell Marker) (ZL7-4), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details