Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Prochlorococcus marinus subsp. pastoris Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

Q7V0U6

Expression Region

1-185

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQSNLSSFNKIEQKINGSRKISNYLIGGMLSIGGIGFILAAISSYTGRDLLPLGNPSTLL FIPQGIIMGAYGVIANLLNIYLWYLVFINFGSGYNFFDKDSQSVEIKRKGLFKDIEVKLS FDEIKSVKLDISEGFNPRRRIALVLKGRKKPLPLSGAGELKPLLQVEEEGARLAKFLNVN LEGLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem97 sgRNA CRISPR Lentivector set (Rat)
K7201201 3x 1.0 µg

Tmem97 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Human TBC1 domain family member 1 ELISA Kit
orb1658839 96 Tests

Human TBC1 domain family member 1 ELISA Kit

Sign In for Pricing
View Details
GPR88 shRNA (h) Lentiviral Particles
sc-75192-V 200 µL

GPR88 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Diazido-methyltetrazine tri-arm
orb2664481-01 25 mg

Diazido-methyltetrazine tri-arm

Sign In for Pricing
View Details
Diazido-methyltetrazine tri-arm
orb2664481-02 50 mg

Diazido-methyltetrazine tri-arm

Sign In for Pricing
View Details
Diazido-methyltetrazine tri-arm
orb2664481-03 100 mg

Diazido-methyltetrazine tri-arm

Sign In for Pricing
View Details