Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Prochlorococcus marinus subsp. pastoris Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

Q7V0U6

Expression Region

1-185

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQSNLSSFNKIEQKINGSRKISNYLIGGMLSIGGIGFILAAISSYTGRDLLPLGNPSTLL FIPQGIIMGAYGVIANLLNIYLWYLVFINFGSGYNFFDKDSQSVEIKRKGLFKDIEVKLS FDEIKSVKLDISEGFNPRRRIALVLKGRKKPLPLSGAGELKPLLQVEEEGARLAKFLNVN LEGLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eogt Antibody
orb805156 2 mg

Eogt Antibody

Sign In for Pricing
View Details
Recombinant Human STYXL1 Protein - (Dry Ice)
H00051657-P01-10ug 10 µg

Recombinant Human STYXL1 Protein - (Dry Ice)

Sign In for Pricing
View Details
VPS54 Blocking Peptide
33R-3011 0.1 mg

VPS54 Blocking Peptide

Sign In for Pricing
View Details
4 4'-Diphenyl-2 2'-bipyridine
D50030-01 500 mg

4 4'-Diphenyl-2 2'-bipyridine

Sign In for Pricing
View Details
4 4'-Diphenyl-2 2'-bipyridine
D50030-02 1000 mg

4 4'-Diphenyl-2 2'-bipyridine

Sign In for Pricing
View Details
4 4'-Diphenyl-2 2'-bipyridine
D50030-03 5000 mg

4 4'-Diphenyl-2 2'-bipyridine

Sign In for Pricing
View Details