Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Bcl-2-like protein 10 (Bcl2l10)

This Recombinant Rat Bcl-2-like protein 10 (Bcl2l10) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

Bcl-2-like protein 10, Bcl2-L-10

UniProt

Q99M66

Expression Region

1-185

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDPLQDRTRRLLTDYILFCARAPNTPEPLPTSVEAALLRSVTSQIQQEHQDLFNSFRDY QGNRLELVTQMADELLSNDQEFNWGRLVMLLAFVGTLMNQDRTVKRRRDQRNRLLLERDC YLIVSLLYNRLTGRHRSWLEAHGGWDGFCQFFKNPLPPGFWRRLLIRAILSCFFATAIFY IWKCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rac1/CDC42 (Ab-71) Antibody
8B7205-AAT 50 µg

Rac1/CDC42 (Ab-71) Antibody

Sign In for Pricing
View Details
Human RNASEK activation kit by CRISPRa
GA118455 1 Kit

Human RNASEK activation kit by CRISPRa

Sign In for Pricing
View Details
PRDM11 Polyclonal Antibody
E-AB-90740-01 60 µL

PRDM11 Polyclonal Antibody

Sign In for Pricing
View Details
PRDM11 Polyclonal Antibody
E-AB-90740-02 120 µL

PRDM11 Polyclonal Antibody

Sign In for Pricing
View Details
PRDM11 Polyclonal Antibody
E-AB-90740-03 200 µL

PRDM11 Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS509582 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details