Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Bcl-2-like protein 10 (Bcl2l10)

This Recombinant Rat Bcl-2-like protein 10 (Bcl2l10) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

Bcl-2-like protein 10, Bcl2-L-10

UniProt

Q99M66

Expression Region

1-185

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDPLQDRTRRLLTDYILFCARAPNTPEPLPTSVEAALLRSVTSQIQQEHQDLFNSFRDY QGNRLELVTQMADELLSNDQEFNWGRLVMLLAFVGTLMNQDRTVKRRRDQRNRLLLERDC YLIVSLLYNRLTGRHRSWLEAHGGWDGFCQFFKNPLPPGFWRRLLIRAILSCFFATAIFY IWKCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Cecum
CB536227 1 Block

Frozen Tissue Blocks, Cecum

Sign In for Pricing
View Details
CD81 / TAPA-1 (C81/2885R), CF488A conjugate, 0.1mg/mL
BNC882885-500 1x 500 µL

CD81 / TAPA-1 (C81/2885R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLCXD1 Mouse Monoclonal Antibody [Clone ID: OTI9D4]
CF808717 100 µg

PLCXD1 Mouse Monoclonal Antibody [Clone ID: OTI9D4]

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS648402 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Annexin A10 Antibody
KC-1304-01 50 μL

Annexin A10 Antibody

Sign In for Pricing
View Details
Annexin A10 Antibody
KC-1304-02 100 µL

Annexin A10 Antibody

Sign In for Pricing
View Details