Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arthrobacter aurescens ATP synthase subunit b (atpF)

This Recombinant Arthrobacter aurescens ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A1R7V6

Expression Region

1-185

Origin

Arthrobacter aurescens (strain TC1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQLIISAATEGAAEANPLVPNVWEMGVVLVGFAVLMYIVVKFVVPMFEKTFAERAEAIE GGIAKAEAAQAEASAALEEYKQQLTDARAEANRIREEARAEGAQILADLKAKAAAESARI TEQAHAAIESERQAAVVSLRSEVGTLATTLAGRIVGEALTDDQRAARVVDRFLADLETQS AGAAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Doxifluridine
TRC-D556750-50MG 50 mg

Doxifluridine

Sign In for Pricing
View Details
Txndc9 Mouse Gene Knockout Kit (CRISPR)
KN518516 1 Kit

Txndc9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DLL1 Polyclonal Antibody
E-AB-70187-01 60 µL

DLL1 Polyclonal Antibody

Sign In for Pricing
View Details
DLL1 Polyclonal Antibody
E-AB-70187-02 120 µL

DLL1 Polyclonal Antibody

Sign In for Pricing
View Details
DLL1 Polyclonal Antibody
E-AB-70187-03 200 µL

DLL1 Polyclonal Antibody

Sign In for Pricing
View Details
Cd4 Rat Monoclonal Antibody [Clone ID: CT-CD4]
CL004R 50 µg

Cd4 Rat Monoclonal Antibody [Clone ID: CT-CD4]

Sign In for Pricing
View Details