Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arthrobacter aurescens ATP synthase subunit b (atpF)

This Recombinant Arthrobacter aurescens ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A1R7V6

Expression Region

1-185

Origin

Arthrobacter aurescens (strain TC1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQLIISAATEGAAEANPLVPNVWEMGVVLVGFAVLMYIVVKFVVPMFEKTFAERAEAIE GGIAKAEAAQAEASAALEEYKQQLTDARAEANRIREEARAEGAQILADLKAKAAAESARI TEQAHAAIESERQAAVVSLRSEVGTLATTLAGRIVGEALTDDQRAARVVDRFLADLETQS AGAAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(4E, 11Z)-Sphingadienine-C18-1-phosphate
TRC-S680640-1MG 1 mg

(4E, 11Z)-Sphingadienine-C18-1-phosphate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB621546 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
Anti-ZNF490
Y058914 100 µg

Anti-ZNF490

Sign In for Pricing
View Details
Cell Meter™ RX780 fixable viability dye
22536-AAT 200 Tests

Cell Meter™ RX780 fixable viability dye

Sign In for Pricing
View Details
Recombinant Human IL-9 protein (His Tag)
PKSH034101-01 20 µg

Recombinant Human IL-9 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IL-9 protein (His Tag)
PKSH034101-02 100 µg

Recombinant Human IL-9 protein (His Tag)

Sign In for Pricing
View Details