Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Opitutus terrae ATP synthase subunit b (atpF)

This Recombinant Opitutus terrae ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B1ZWP0

Expression Region

1-185

Origin

Opitutus terrae (strain DSM 11246 / PB90-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPLFLAAAEAHVAEPGLVAELVEKFGLDPKYILIQTFSFLIVLGILYRFAIKPTIAAME ERAEKVGAGLKYAEEMQAKLAAAQQESAAIVKKSQVEASRIVDEARRTAKDYLDKQTQEA AAKASETIAKAQQAIELEHRKMLADARTEIARLVVITTERVLAQKLSDSDRAAYNASATR ELTNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TentaGel® MB AC
MB250110.5G 5 g

TentaGel® MB AC

Sign In for Pricing
View Details
26S proteasome non ATPase reguLatory subunit 12 (PSMD12) (NM_174871) Human Over-expression Lysate
LC430412 20 µg

26S proteasome non ATPase reguLatory subunit 12 (PSMD12) (NM_174871) Human Over-expression Lysate

Sign In for Pricing
View Details
Cbx8 Recombinant Rabbit Monoclonal Antibody [PSH06-61]
HA722734 100 µL

Cbx8 Recombinant Rabbit Monoclonal Antibody [PSH06-61]

Sign In for Pricing
View Details
Vmn1r180 Mouse Gene Knockout Kit (CRISPR)
KN518972 1 Kit

Vmn1r180 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Endothelin 1 (EDN1) (NM_001168319) Human Over-expression Lysate
LC432690 20 µg

Endothelin 1 (EDN1) (NM_001168319) Human Over-expression Lysate

Sign In for Pricing
View Details
Araf Mouse Gene Knockout Kit (CRISPR)
KN501461 1 Kit

Araf Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details