Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Potassium-transporting ATPase C chain (kdpC)

This Recombinant Staphylococcus aureus Potassium-transporting ATPase C chain (kdpC) spans the amino acid sequence from region 1-186.

Product Specifications

Product Name Alternative

Potassium-transporting ATPase C chain, EC= 3.6.3.12, ATP phosphohydrolase [potassium-transporting] C chain, Potassium-binding and translocating subunit C, Potassium-translocating ATPase C chain

UniProt

A6QIS0

Expression Region

1-186

Origin

Staphylococcus aureus (strain Newman)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTIRNSICLTIITMVLCGFLFPLAITLIGQIFFYQQANGSLITYDNRIVGSKLIGQHWT ETRYFHGRPSAVDYNMNPEKLYKNGVSSGGSNESNGNTELIARMKHHVKFGNSNVTIDAA TSSGSGLDPHITVENALKQAPRIADARHVSTSRVADLIQHRKQRGVLTNDYVNVLELNIA LDKMKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRASLS3 (PLA2G16) (NM_001128203) Human Recombinant Protein
TP325152M 100 µg

HRASLS3 (PLA2G16) (NM_001128203) Human Recombinant Protein

Sign In for Pricing
View Details
Fenoxycarb-d3
TRC-F248871-1MG 1 mg

Fenoxycarb-d3

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR562007 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
Vicia villosa Gel -VVA- Immobilized Lectin
A-4601-5 5 mL

Vicia villosa Gel -VVA- Immobilized Lectin

Sign In for Pricing
View Details
Recombinant PLCG1 Antibody
RC-16400-01 50 μL

Recombinant PLCG1 Antibody

Sign In for Pricing
View Details
Recombinant PLCG1 Antibody
RC-16400-02 100 µL

Recombinant PLCG1 Antibody

Sign In for Pricing
View Details