Recombinant Rhodobacter capsulatus ATP synthase subunit b' (atpG)
This Recombinant Rhodobacter capsulatus ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-186.
Product Specifications
Product Name Alternative
ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'
UniProt
O05332
Expression Region
1-186
Origin
Rhodobacter capsulatus (Rhodopseudomonas capsulata)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MANETNAVEAAAAVAGHAAEAAEKGGMPQLDFSTFPNQIFWLLLALGAIYWLLKNIAIPR IAAILADRAGTISGDLAAAEQYKLKAKDAEAAYAKALADARAQAQKIIAETRAVIQKDLD AATAKADADIAARVAQSEVKIAEIRAGALEAVQIVATDTATAIVTALGGKADMGALNAAV GQRVKG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882342-100 1x 100 µL
Calcineurin B / PPP3R1 (CALNB/2342), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
P014-405M-500 1x 500 µL
CD81 Recombinant Monoclonal Mouse Antibody (2304.81), CF®405M Conjugate - Biotium Choice
Sign In for Pricing
View Details 
LC402402 20 µg
RanBP16 (XPO7) (NM_015024) Human Over-expression Lysate
Sign In for Pricing
View Details 