Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Potassium-transporting ATPase C chain (kdpC)

This Recombinant Staphylococcus aureus Potassium-transporting ATPase C chain (kdpC) spans the amino acid sequence from region 1-186.

Product Specifications

Product Name Alternative

Potassium-transporting ATPase C chain, EC= 3.6.3.12, ATP phosphohydrolase [potassium-transporting] C chain, Potassium-binding and translocating subunit C, Potassium-translocating ATPase C chain

UniProt

Q2YUH8

Expression Region

1-186

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTIRNSICLTIITMVLCGFLFPLAITLIGQIFFYQQANGSLITYDNRIVGSKLIGQHWT DTRYFHGRPSAVDYNMNPEKLYKNGVSSGGSNESNGNTELIARVKHHVKFGNSNVTIDAA TSSGSGLDPHITVENALKQAPRIADARHISTSRVTDLIQHRMQRGVLTNDYVNVLELNIA LDKMKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XRCC5 Antibody
CSB-PA003115-01 50 µg

XRCC5 Antibody

Sign In for Pricing
View Details
XRCC5 Antibody
CSB-PA003115-02 100 µg

XRCC5 Antibody

Sign In for Pricing
View Details
ERBB2, phosphorylated (Y1005) (ERBB2, HER2, MLN19, NEU, NGL, Receptor tyrosine-protein kinase erbB-2, Metastatic lymph node gene 19 protein, Proto-oncogene Neu, Proto-oncogene c-ErbB-2, Tyrosine kinase-type cell surface receptor HER2, p185erbB2, CD340) (PE) discontinued
035179-PE 200 µL

ERBB2, phosphorylated (Y1005) (ERBB2, HER2, MLN19, NEU, NGL, Receptor tyrosine-protein kinase erbB-2, Metastatic lymph node gene 19 protein, Proto-oncogene Neu, Proto-oncogene c-ErbB-2, Tyrosine kinase-type cell surface receptor HER2, p185erbB2, CD340) (PE) discontinued

Sign In for Pricing
View Details
C13orf28 Rabbit Polyclonal Antibody (HRP)
orb2114975 100 µL

C13orf28 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
T7 tag Mouse mAb, PerCP-Cy5.5 conjugated
orb2369753 100 µL

T7 tag Mouse mAb, PerCP-Cy5.5 conjugated

Sign In for Pricing
View Details
PBiT2.1-N TK-SmBiT-Clock Plasmid
PVT74298 2 µg

PBiT2.1-N TK-SmBiT-Clock Plasmid

Sign In for Pricing
View Details