Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Corynebacterium jeikeium ATP synthase subunit b (atpF)

This Recombinant Corynebacterium jeikeium ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-186.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q4JUJ6

Expression Region

1-186

Origin

Corynebacterium jeikeium (strain K411)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNTFLLAAEKLPMEESVNPLIPPLYDIVWSIIPFAVILFVFWKFVLPKFQEVLNQREDQ IEGGIRRAESAQAEAKAALEKYNAQLAEARTEAAQIRDDARSQGQKIIADMKAQATEESN RIVESGHKQLEAQRSAVVTDLRKEMGENSINLAERLLGEQLSDDVKRSGTIDNFLAGLDN VGASGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Upstream Binding Protein 1 (UBP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9C7]
TA808815BM 100 µL

Upstream Binding Protein 1 (UBP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9C7]

Sign In for Pricing
View Details
Slc18a2 (496-515) Rabbit Polyclonal Antibody
20042 100 µL

Slc18a2 (496-515) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MRPS34 Human Gene Knockout Kit (CRISPR)
KN400834 1 Kit

MRPS34 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LOC105369261 Mouse Monoclonal Antibody [Clone ID: SPM503]
AM50171PU-T 20 µg

LOC105369261 Mouse Monoclonal Antibody [Clone ID: SPM503]

Sign In for Pricing
View Details
EMA (MUC1) Human Gene Knockout Kit (CRISPR)
KN219922BN 1 Kit

EMA (MUC1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LUC7L Human Gene Knockout Kit (CRISPR)
KN400146 1 Kit

LUC7L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details