Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Corynebacterium jeikeium ATP synthase subunit b (atpF)

This Recombinant Corynebacterium jeikeium ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-186.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q4JUJ6

Expression Region

1-186

Origin

Corynebacterium jeikeium (strain K411)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNTFLLAAEKLPMEESVNPLIPPLYDIVWSIIPFAVILFVFWKFVLPKFQEVLNQREDQ IEGGIRRAESAQAEAKAALEKYNAQLAEARTEAAQIRDDARSQGQKIIADMKAQATEESN RIVESGHKQLEAQRSAVVTDLRKEMGENSINLAERLLGEQLSDDVKRSGTIDNFLAGLDN VGASGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DL-Leucyl-glycine
TRC-L113520-1MG 1 mg

DL-Leucyl-glycine

Sign In for Pricing
View Details
a-Chloralose ("may contain up to xx % of beta anomer")
TRC-A576005-5G 5 g

a-Chloralose ("may contain up to xx % of beta anomer")

Sign In for Pricing
View Details
HOXA10 (NM_018951) Human Over-expression Lysate
LC402717 20 µg

HOXA10 (NM_018951) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Protein Lysate, Stomach
CP565587 150 µg

Tissue Protein Lysate, Stomach

Sign In for Pricing
View Details
TXNDC5 (NM_022085) Human Recombinant Protein
TP308568L 1 mg

TXNDC5 (NM_022085) Human Recombinant Protein

Sign In for Pricing
View Details
Art2a Rabbit Polyclonal Antibody
TA363429 100 µL

Art2a Rabbit Polyclonal Antibody

Sign In for Pricing
View Details