Recombinant Xenopus tropicalis Mitochondrial import inner membrane translocase subunit Tim22 (timm22)
This Recombinant Xenopus tropicalis Mitochondrial import inner membrane translocase subunit Tim22 (timm22) spans the amino acid sequence from region 1-186.
Product Specifications
Product Name Alternative
Mitochondrial import inner membrane translocase subunit Tim22
UniProt
Q5M7K0
Expression Region
1-186
Origin
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MGGSVSPPGTGEGTLQYSLIMEHLVGDKRRPKEVIPGGLGGIPTPIKSEEQKMMERVMES CGFKAALACVGGFVLGGAFGVFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKN FAIVGAMFSCTECLVESYRGKSDWKNSVISGCITGGAIGFRAGLKAGALGCGGFAAFSAV IDYYLR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400965-100 1x 100 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402167-100 1x 100 µL
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details