Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Mitoferrin-2A (slc25a28-a)

This Recombinant Xenopus laevis Mitoferrin-2A (slc25a28-a) spans the amino acid sequence from region 1-186.

Product Specifications

Product Name Alternative

Mitoferrin-2A, Mitochondrial iron transporter 2-A, Solute carrier family 25 member 28-A

UniProt

Q6GLJ0

Expression Region

1-186

Origin

Xenopus laevis (African clawed frog)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELEAVLKERTAAAGDPGRVLGAWVRSGWSAAGPSVLESEGGSGGPLAFESTSSRILELA SKDNEPEYEALPDGSNVTTHMLAGAVAGVMEHCLMYPVDCVKTRMQSLQPDPAARYRNVM DALSKIVRTEGFWRPLRGLNVTATGAGPAHALYFACYEKLKKTLSDIIHPGGNSHIANGT DYSCPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ECPAS Antibody
RN-12777-01 50 μL

Recombinant ECPAS Antibody

Sign In for Pricing
View Details
Recombinant ECPAS Antibody
RN-12777-02 100 µL

Recombinant ECPAS Antibody

Sign In for Pricing
View Details
Recombinant ECPAS Antibody
RN-12777-03 1 mL

Recombinant ECPAS Antibody

Sign In for Pricing
View Details
EIF3CL Human Gene Knockout Kit (CRISPR)
KN423143 1 Kit

EIF3CL Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human PSMD11 activation kit by CRISPRa
GA103884 1 Kit

Human PSMD11 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), 1mg/mL
BNUM1989-50 1x 50 µL

Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), 1mg/mL

Sign In for Pricing
View Details