Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Protein ECHIDNA (ECH)

This Recombinant Arabidopsis thaliana Protein ECHIDNA (ECH) spans the amino acid sequence from region 1-186.

Product Specifications

Product Name Alternative

Protein ECHIDNA

UniProt

Q8LEK2

Expression Region

1-186

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPNNQIQAPVENYANPRTCLFHVLFKGAALAFYILSALFFNSFVIIFVVTVLLAALDFW VVKNVSGRILVGLRWWNEINDLGESVWKFESLDQESLARMNKKDSWLFWWTLYLAAAAWF ILGVFSLIRFQADYLLVVGVCLSLNVANIIGFTKCKKDAKKQFQQFASQTIASRFQSTVQ SAFTLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 7 (K72.7), Biotin conjugate, 0.1mg/mL
BNCB0757-500 1x 500 µL

Cytokeratin 7 (K72.7), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FABP2 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP2-3), CF488A conjugate, 0.1mg/mL
BNC882226-500 1x 500 µL

FABP2 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP2-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTC19 (NM_017775) Human Recombinant Protein
TP311271L 1 mg

TTC19 (NM_017775) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant PRPF8 Antibody
RC-15856-01 50 μL

Recombinant PRPF8 Antibody

Sign In for Pricing
View Details
Recombinant PRPF8 Antibody
RC-15856-02 100 µL

Recombinant PRPF8 Antibody

Sign In for Pricing
View Details
Recombinant PRPF8 Antibody
RC-15856-03 1 mL

Recombinant PRPF8 Antibody

Sign In for Pricing
View Details