Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Corynebacterium urealyticum ATP synthase subunit b (atpF)

This Recombinant Corynebacterium urealyticum ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-186.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B1VFY3

Expression Region

1-186

Origin

Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNTFFLAAETLPLEEPINPLIPPLYDIVWSIIPFAVILFVFAKVVLPKFQEVLTQREDK IEGGIQRAEAAKAEAQEALEKYNKQLAEARTEAAQIRDDARSQGQKIIADMKTQATEESN RIVEAGNKQLEANRASVVADLRKEMGENSINLAERLLGEQLNDDVKRSGTIDNFLAGLDN VGTAGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CREM Recombinant Protein (Mouse)
RP125999 100 µg

CREM Recombinant Protein (Mouse)

Sign In for Pricing
View Details
BRMS1L Antibody - C-terminal region : Biotin (ARP60403_P050-Biotin)
ARP60403_P050-Biotin 100 µL

BRMS1L Antibody - C-terminal region : Biotin (ARP60403_P050-Biotin)

Sign In for Pricing
View Details
Anti-Beta Arrestin 2 antibody
MBS176267-01 0.01 mg

Anti-Beta Arrestin 2 antibody

Sign In for Pricing
View Details
Anti-Beta Arrestin 2 antibody
MBS176267-02 0.1 mg (Carrier Free)

Anti-Beta Arrestin 2 antibody

Sign In for Pricing
View Details
Anti-Beta Arrestin 2 antibody
MBS176267-03 0.1 mg

Anti-Beta Arrestin 2 antibody

Sign In for Pricing
View Details
Anti-Beta Arrestin 2 antibody
MBS176267-04 0.1 mg (Cy3)

Anti-Beta Arrestin 2 antibody

Sign In for Pricing
View Details