Recombinant Zea mays Oleosin Zm-II (OLE18)
This Recombinant Zea mays Oleosin Zm-II (OLE18) spans the amino acid sequence from region 2-187.
Product Specifications
Product Name Alternative
Oleosin Zm-II, Lipid body-associated protein L2, Oleosin 18 kDa
UniProt
P21641
Expression Region
2-187
Origin
Zea mays (Maize)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
ADRDRSGIYGGAHATYGQQQQQGGGGRPMGEQVKKGMLHDKGPTASQALTVATLFPLGGL LLVLSGLALTASVVGLAVATPVFLIFSPVLVPAALLIGTAVMGFLTSGALGLGGLSSLTC LANTARQAFQRTPDYVEEARRRMAEAAAQAGHKTAQAGQAIQGRAQEAGTGGGAGAGAGG GGRASS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470806-100 1x 100 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682848-500 1x 500 µL
Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041099-500 1x 500 µL
CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details