Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

P48192

Expression Region

1-187

Origin

Cyanophora paradoxa

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLKNNTDQIKRDLITGSRRLSNYWWAITIGLGSSGFILAGISSYTKINLLPFTDTTQFL FIPQGITMLLYGTIGFLLDIYLWLLILWNVGAGYNEYNKKKGTVSIFRWGFPGTNRRIEV IYPIEQIQAIKLEIKQGLNPRHSISLKIQEKNEIVITPIGYLLPISVVEEQAANLASFLN IPLDSNQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant pTau217 Antibody
RC-023-01 50 μL

Recombinant pTau217 Antibody

Sign In for Pricing
View Details
Recombinant pTau217 Antibody
RC-023-02 100 µL

Recombinant pTau217 Antibody

Sign In for Pricing
View Details
Recombinant pTau217 Antibody
RC-023-03 1 mL

Recombinant pTau217 Antibody

Sign In for Pricing
View Details
Diethyl Phosphate Sodium Salt
TRC-D444720-250MG 250 mg

Diethyl Phosphate Sodium Salt

Sign In for Pricing
View Details
Hydroxyprogesterone ELISA Kit
K053-H5 5 Plates

Hydroxyprogesterone ELISA Kit

Sign In for Pricing
View Details
Glycophorin A / CD235a (Erythrocyte Marker) (N/A), CF740 conjugate, 0.1mg/mL
BNC741736-100 1x 100 µL

Glycophorin A / CD235a (Erythrocyte Marker) (N/A), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details