Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative transmembrane protein LOC401397

This Recombinant Human Putative transmembrane protein LOC401397 spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Putative transmembrane protein LOC401397

UniProt

A4D0T7

Expression Region

1-187

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSETPKQKARDAKFMLVKRLWQDKDGHLCRIVLHDHGWNPSETPVGPQMHGARSLSMEE SAAAGIVGNVVWRLRPPRHSCNGCFLEGRVTWNLLISASGAPGRENFKSDRILYIPFLGT FSPQDSNIMTSVSTQLSLVLMSLLLVLPVVEAVEAGDAIALLLGVVLSITGICACLGVYA RKRNGQM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C20orf202 Human Gene Knockout Kit (CRISPR)
KN425065 1 Kit

C20orf202 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Adenosine-1'-13C
TRC-A280403-2.5MG 2.5 mg

Adenosine-1'-13C

Sign In for Pricing
View Details
rac Alpha-Ethyl DOPA Hydrobromide
TRC-E917280-25MG 25 mg

rac Alpha-Ethyl DOPA Hydrobromide

Sign In for Pricing
View Details
Human IgG (Fcγ Fragment specific), AlpHcAbs® Goat antibody (HRP)
HA710064 100 µg

Human IgG (Fcγ Fragment specific), AlpHcAbs® Goat antibody (HRP)

Sign In for Pricing
View Details
Cig2 (3A11/5), CF594 conjugate, 0.1mg/mL
BNC942827-100 1x 100 µL

Cig2 (3A11/5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Potassium Cyanate
TRC-P695065-50G 50 g

Potassium Cyanate

Sign In for Pricing
View Details