Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arthroderma otae Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

This Recombinant Arthroderma otae Altered inheritance of mitochondria protein 31, mitochondrial (AIM31) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Altered inheritance of mitochondria protein 31, mitochondrial

UniProt

C5FSQ7

Expression Region

1-187

Origin

Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) (Microsporum canis)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDKPLPSSFDDNPDFFQDNPWKKLGRRLKEEPLVPLGIGATCYALFRAYRSMKMGDSVQ VNRMFRARIYAQAFTLLAVCAGSVYYKTERDQRKQLEKAMDLKKQQTKRDAWLKELEIRD QEDKDWQSRHAAIEQAAKGAELKPLGTDPAPETAERDQAEEPAAKEPGEGSGGGVLSAVK NLTWGSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL
BNC880034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-100 1x 100 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF488A conjugate, 0.1mg/mL
BNC880160-500 1x 500 µL

CD20 (B9E9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF647 conjugate, 0.1mg/mL
BNC470039-100 1x 100 µL

CD34 (ICO-115), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
BNC470391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details