Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YPR142C (YPR142C)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YPR142C (YPR142C) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Putative uncharacterized protein YPR142C

UniProt

O13570

Expression Region

1-187

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMGSFLSYAFRCDDKIAFTAAENPVEPSSCLLFFDFFFLGKSSSSSSSSSSSSASLCSLS IILDDSSLELFCSSSSASSPSIIVSFSGSLLNSWLPLFLFSRPNSAFFLVLFLSLVSTLC LEPMINYVLIFLRLLYRFIHSICLLPFLISYGHRILDFFLSKFSNKRVMEIHQNESQTKS KQTLFTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Small intestine
CS805415 5x 5 µm

Tissue FFPE Sections, Small intestine

Sign In for Pricing
View Details
OR5J2 (NM_001005492) Human Over-expression Lysate
LC423601 20 µg

OR5J2 (NM_001005492) Human Over-expression Lysate

Sign In for Pricing
View Details
3-(1,3-Dithian-2-ylidene)pentane-2,4-dione
TRC-D493860-500MG 500 mg

3-(1,3-Dithian-2-ylidene)pentane-2,4-dione

Sign In for Pricing
View Details
POLD2 Polyclonal Antibody
E-AB-52969-01 20 µL

POLD2 Polyclonal Antibody

Sign In for Pricing
View Details
POLD2 Polyclonal Antibody
E-AB-52969-02 60 µL

POLD2 Polyclonal Antibody

Sign In for Pricing
View Details
POLD2 Polyclonal Antibody
E-AB-52969-03 120 µL

POLD2 Polyclonal Antibody

Sign In for Pricing
View Details