What is the catalog number for Recombinant Takifugu rubripes Putative protein 2?

The catalog number for Recombinant Takifugu rubripes Putative protein 2 is orb2929873.

What sizes are available for Recombinant Takifugu rubripes Putative protein 2?

Recombinant Takifugu rubripes Putative protein 2 is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Takifugu rubripes Putative protein 2 come in?

Recombinant Takifugu rubripes Putative protein 2 is available in 2 different pack sizes.

Is Recombinant Takifugu rubripes Putative protein 2 in stock?

Recombinant Takifugu rubripes Putative protein 2 is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Takifugu rubripes Putative protein 2

This Recombinant Takifugu rubripes Putative protein 2 spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Putative protein 2, PUT2

UniProt

O73698

Expression Region

1-187

Origin

Takifugu rubripes (Japanese pufferfish) (Fugu rubripes)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSDREGLWMLAAFALMTLFLLDNVGVTQAKSFDDVRCKCICPPYRNISGHIYNRNFTQK DCNCLHVVDPMPVPGNDVEAYCLLCECKYEERSTNTIRVTIIIFLSVVGALLLYMLFLLL VDPLIRKPDPLAQTLHNEEDSEDIQPQMSGDPARGNTVLERVEGAQQRWKKQVQEQRKTV FDRHKML