What is the catalog number for Recombinant Laccaria bicolor Protein GET1 (GET1)?

The catalog number for Recombinant Laccaria bicolor Protein GET1 (GET1) is orb2929872.

What sizes are available for Recombinant Laccaria bicolor Protein GET1 (GET1)?

Recombinant Laccaria bicolor Protein GET1 (GET1) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Laccaria bicolor Protein GET1 (GET1) come in?

Recombinant Laccaria bicolor Protein GET1 (GET1) is available in 2 different pack sizes.

Is Recombinant Laccaria bicolor Protein GET1 (GET1) in stock?

Recombinant Laccaria bicolor Protein GET1 (GET1) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Laccaria bicolor Protein GET1 (GET1)

This Recombinant Laccaria bicolor Protein GET1 (GET1) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Protein GET1, Guided entry of tail-anchored proteins 1

UniProt

B0D1L7

Expression Region

1-187

Origin

Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) (Bicoloured deceiver) (Laccaria laccata var. bicolor)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLITIFLLVFITQLVSWIGQTVLLELAYALYLRLTRSAAFARQQALKSEILATKSELL KTSAQDQFAKWAKLRRSVDKGLADLEKLNSQIASSKSSFSLKFNSAIWILTTGVQFVVGW WYRRQPVFYLPEGWFGPLAWWLAFPFAPAGSVSVGVWQMACKRVVVLGERVVKDLTGESL DYVHVSS