Recombinant Methylobacterium sp. ATP synthase subunit b/b' (atpG)
This Recombinant Methylobacterium sp. ATP synthase subunit b/b' (atpG) spans the amino acid sequence from region 1-187.
Product Specifications
Product Name Alternative
ATP synthase subunit b/b', ATP synthase F (0) sector subunit b/b', ATPase subunit II, F-type ATPase subunit b/b', F-ATPase subunit b/b'
UniProt
B0ULY3
Expression Region
1-187
Origin
Methylobacterium sp. (strain 4-46)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAQPTPHAGLQEGLIHEPASEHGGGFPPFQSTTFAAQILWLAIAFGLLYYLMSRVAVPRI AGLLHDRQARLAADLDEASRMKTGADSARGAYERSLKEAQDKAKGIAQATRDSLAAEAET RRKALEADLAAKLAESEAQIRARTATAMGSVREVAADAATAIVERLIGQSPDRAAVEAAY DRTQTVH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2071564-01 0.1 mL
FITC-Linked Polyclonal Antibody to Tropomyosin 3 (TPM3)
Sign In for Pricing
View Details MBS2071564-02 0.2 mL
FITC-Linked Polyclonal Antibody to Tropomyosin 3 (TPM3)
Sign In for Pricing
View Details MBS2071564-03 0.5 mL
FITC-Linked Polyclonal Antibody to Tropomyosin 3 (TPM3)
Sign In for Pricing
View Details MBS2071564-04 1 mL
FITC-Linked Polyclonal Antibody to Tropomyosin 3 (TPM3)
Sign In for Pricing
View Details