Recombinant Trichodesmium erythraeum Photosystem I assembly protein Ycf4 (ycf4)
This Recombinant Trichodesmium erythraeum Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-187.
Product Specifications
Product Name Alternative
Photosystem I assembly protein Ycf4
UniProt
Q118V7
Expression Region
1-187
Origin
Trichodesmium erythraeum (strain IMS101)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTTQTSTGDRLVHQEIIGSRRLSNYLWAIIVTMGGIGFLLSGISSYLKVNLLIVADPTQL NFLPQGIAMSFYGLLGTIYGIFLWLTVIWDLGGGYNDFNQESGQIMIFRRGFPGKNRKVE FNCTTENVQSIKVDIKEGLNPRRAIYLCLKDRRQIPLTRVGQPLALSKLENEAAQLAKFL QVPLEGL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740226-100 1x 100 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041556-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (EGP40/1556R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682871-100 1x 100 µL
Prostate Specific Antigen (PSA) (KLK3/2871R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040444-500 1x 500 µL
Pmel17 / gp100 / SILV (HMB45), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details