Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit b (atpF)

This Recombinant Synechococcus sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q2JIF8

Expression Region

1-187

Origin

Synechococcus sp. (strain JA-2-3B'a (2-13) ) (Cyanobacteria bacterium Yellowstone B-Prime)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVWSWVAGWILAVAETTELLPEAKAGEGDLLAKILESNLINIAIILTLLFILGRKVVGE ALAKRREGILEELRQAEQRKREAIERLAEEQQKLAQAQQEAERIRKQAEANAEARRQELL EQAEREVERLRANAEKELSSEQERVFQELRRQIVRQALSKVEQELPQHLNEEVHRSLIEK GIQMIAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atrx Mouse shRNA Lentiviral Particle (Locus ID 22589)
TL502431V 500 µL Each

Atrx Mouse shRNA Lentiviral Particle (Locus ID 22589)

Sign In for Pricing
View Details
Zebrafish PSMA1 Rabbit Polyclonal Antibody (HRP)
orb2817621 100 µg

Zebrafish PSMA1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
VTCN1 Protein Lysate (Mouse) with C-HA Tag
50219034 100 µg

VTCN1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
EBV EBNA-1 (3EB8)
sc-81584 200 µg/mL

EBV EBNA-1 (3EB8)

Sign In for Pricing
View Details
Rat Arl8a Pre-designed siRNA Set A
SI200937A 1 Each

Rat Arl8a Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Escherichia coli O8 Putative phosphotransferase ydiA (ydiA)
MBS1014288-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O8 Putative phosphotransferase ydiA (ydiA)

Sign In for Pricing
View Details