Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit b (atpF)

This Recombinant Synechococcus sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q2JIF8

Expression Region

1-187

Origin

Synechococcus sp. (strain JA-2-3B'a (2-13) ) (Cyanobacteria bacterium Yellowstone B-Prime)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVWSWVAGWILAVAETTELLPEAKAGEGDLLAKILESNLINIAIILTLLFILGRKVVGE ALAKRREGILEELRQAEQRKREAIERLAEEQQKLAQAQQEAERIRKQAEANAEARRQELL EQAEREVERLRANAEKELSSEQERVFQELRRQIVRQALSKVEQELPQHLNEEVHRSLIEK GIQMIAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oleoyl-L-carnitine-13C3
TRC-O526703-25MG 25 mg

Oleoyl-L-carnitine-13C3

Sign In for Pricing
View Details
Cbr2 3'UTR Luciferase Stable Cell Line
TU103195 1.0 mL

Cbr2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
MYLIP Lentiviral Activation Particles (m2)
sc-432282-LAC-2 200 µL

MYLIP Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
PI3KC3 (S425) (PIK3C3, VPS34, Phosphatidylinositol 3-kinase catalytic subunit type 3, Phosphatidylinositol 3-kinase p100 subunit, Phosphoinositide-3-kinase class 3, hVps34) (MaxLight 490) discontinued
039980-ML490 100 µL

PI3KC3 (S425) (PIK3C3, VPS34, Phosphatidylinositol 3-kinase catalytic subunit type 3, Phosphatidylinositol 3-kinase p100 subunit, Phosphoinositide-3-kinase class 3, hVps34) (MaxLight 490) discontinued

Sign In for Pricing
View Details
D-Hanks Powder (1x, no phenol red), 1 pack = 1 L
BAL248 1 Pack

D-Hanks Powder (1x, no phenol red), 1 pack = 1 L

Sign In for Pricing
View Details
Zinc Pyrithione
C17414 10 mM / 1 mL

Zinc Pyrithione

Sign In for Pricing
View Details