Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Erythrobacter litoralis ATP synthase subunit b (atpF)

This Recombinant Erythrobacter litoralis ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q2N9P5

Expression Region

1-187

Origin

Erythrobacter litoralis (strain HTCC2594)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANTPEPLTTEAAQVVSETDLGAAKLLEPSALWLEPYQWVSVAMLVLIAIMLWKKVPSLV TGGLDNKIAEIKAQLDEAKALRAEAEKLRDEYTAKIANAEKDAEAMMENARHEADAILEK AEADSKALVERRKKMAEDKISAAERDAVDEVRATAAAAAAAASRKLIAEKHDAEADRKLA DEVIAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3E Antibody
A17914-100UG 100 µg

CD3E Antibody

Sign In for Pricing
View Details
Recombinant Nostoc sp. NAD (P)H-quinone oxidoreductase chain 4 1 (ndhD1), partial
MBS7095022 Inquire

Recombinant Nostoc sp. NAD (P)H-quinone oxidoreductase chain 4 1 (ndhD1), partial

Sign In for Pricing
View Details
SPAC1348.06c Antibody
orb858282 2 mg

SPAC1348.06c Antibody

Sign In for Pricing
View Details
Human Aquaporin 1 (AQP-1) ELISA Kit
YP-W11319-01 48 Tests

Human Aquaporin 1 (AQP-1) ELISA Kit

Sign In for Pricing
View Details
Human Aquaporin 1 (AQP-1) ELISA Kit
YP-W11319-02 96 Tests

Human Aquaporin 1 (AQP-1) ELISA Kit

Sign In for Pricing
View Details
MIR4508 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV769355 1.0 µg DNA

MIR4508 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details