Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Erythrobacter litoralis ATP synthase subunit b (atpF)

This Recombinant Erythrobacter litoralis ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q2N9P5

Expression Region

1-187

Origin

Erythrobacter litoralis (strain HTCC2594)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANTPEPLTTEAAQVVSETDLGAAKLLEPSALWLEPYQWVSVAMLVLIAIMLWKKVPSLV TGGLDNKIAEIKAQLDEAKALRAEAEKLRDEYTAKIANAEKDAEAMMENARHEADAILEK AEADSKALVERRKKMAEDKISAAERDAVDEVRATAAAAAAAASRKLIAEKHDAEADRKLA DEVIAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ki-67 (Antigen Identified by Monoclonal Antibody Ki-67, KIA, MKI67, Proliferation Related Ki-67 Antigen) (AP) discontinued
K1700-05C-AP 100 µL

Ki-67 (Antigen Identified by Monoclonal Antibody Ki-67, KIA, MKI67, Proliferation Related Ki-67 Antigen) (AP) discontinued

Sign In for Pricing
View Details
C-Jun, phosphorylated (Thr91, Thr93) (FITC) discontinued
C5815-14-FITC 100 µL

C-Jun, phosphorylated (Thr91, Thr93) (FITC) discontinued

Sign In for Pricing
View Details
5-Ethoxy-1H-indole-3-carbaldehyde ≥95% (HPLC)
234156-01 250 mg

5-Ethoxy-1H-indole-3-carbaldehyde ≥95% (HPLC)

Sign In for Pricing
View Details
5-Ethoxy-1H-indole-3-carbaldehyde ≥95% (HPLC)
234156-02 1 g

5-Ethoxy-1H-indole-3-carbaldehyde ≥95% (HPLC)

Sign In for Pricing
View Details
5-Ethoxy-1H-indole-3-carbaldehyde ≥95% (HPLC)
234156-03 5 g

5-Ethoxy-1H-indole-3-carbaldehyde ≥95% (HPLC)

Sign In for Pricing
View Details
OR4C14P 3'UTR Lenti-reporter-Luc Vector
35179081 1.0 µg

OR4C14P 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details