Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acidianus two-tailed virus Structural protein ORF187

This Recombinant Acidianus two-tailed virus Structural protein ORF187 spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Structural protein ORF187

UniProt

Q3V4V6

Expression Region

1-187

Origin

Acidianus two-tailed virus (ATV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTTFDKDQENEQQQQDAQAIWKKILSPGARITKDDVDFAIDNLESAPDVPYEFMYATFS PNAKIYQPTAIAVSGVGGIIGALLALKRALQYGGPKYYVTTEEVIKATDQKSPLYLANYA LNRLLKAYPAQVVVIKPDDFDKIKTLLSSGGVYISGLPYETLIPISQLSGFGRIWHYSPI QKKFFVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clioquinol
TRC-C581100-50G 50 g

Clioquinol

Sign In for Pricing
View Details
Potassium Sulphate
TRC-P698305-50G 50 g

Potassium Sulphate

Sign In for Pricing
View Details
Bhlhe40 Mouse Gene Knockout Kit (CRISPR)
KN502159 1 Kit

Bhlhe40 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ctip1 Recombinant Rabbit monoclonal Antibody
HA750461 100 µL

Ctip1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CD2 Protein (His Tag)
PKSH031320-01 100 µg

Recombinant Human CD2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CD2 Protein (His Tag)
PKSH031320-02 1 mg

Recombinant Human CD2 Protein (His Tag)

Sign In for Pricing
View Details