Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat High affinity copper uptake protein 1 (Slc31a1)

This Recombinant Rat High affinity copper uptake protein 1 (Slc31a1) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

High affinity copper uptake protein 1, Copper transporter 1, rCTR1, Liver regeneration-related protein LRRGT00200, Solute carrier family 31 member 1

UniProt

Q9JK41

Expression Region

1-187

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRMNHMEMHHMGMNHTDDNITMPPHQHPTTSASHSHEMMMPMTFYFGFKNVDLLFSSLVI NTPGEMAGAFVAVFLLAMFYEGLKIAREGLLRKSQVSIRYNSMPVPGPNGTILMETHKTV GQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVV DITEHCH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ticagrelor Epimer
TRC-D232260-5MG 5 mg

Ticagrelor Epimer

Sign In for Pricing
View Details
Monopropylheptylphthalate 6-Hydroxy-d4
TRC-M567077-1MG 1 mg

Monopropylheptylphthalate 6-Hydroxy-d4

Sign In for Pricing
View Details
Cicer arietinum Gel -CPA- Immobilized Lectin
AK-6601-2 2 mL

Cicer arietinum Gel -CPA- Immobilized Lectin

Sign In for Pricing
View Details
FNDC3A Rabbit Polyclonal Antibody
ER1803-66 100 µL

FNDC3A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human C9orf93 (CCDC171) activation kit by CRISPRa
GA116438 1 Kit

Human C9orf93 (CCDC171) activation kit by CRISPRa

Sign In for Pricing
View Details
Human ILRUN activation kit by CRISPRa
GA112134 1 Kit

Human ILRUN activation kit by CRISPRa

Sign In for Pricing
View Details