Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat High affinity copper uptake protein 1 (Slc31a1)

This Recombinant Rat High affinity copper uptake protein 1 (Slc31a1) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

High affinity copper uptake protein 1, Copper transporter 1, rCTR1, Liver regeneration-related protein LRRGT00200, Solute carrier family 31 member 1

UniProt

Q9JK41

Expression Region

1-187

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRMNHMEMHHMGMNHTDDNITMPPHQHPTTSASHSHEMMMPMTFYFGFKNVDLLFSSLVI NTPGEMAGAFVAVFLLAMFYEGLKIAREGLLRKSQVSIRYNSMPVPGPNGTILMETHKTV GQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVV DITEHCH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EP-CAM Polyclonal Antibody
BT-AP02987-01 20 µL

EP-CAM Polyclonal Antibody

Sign In for Pricing
View Details
EP-CAM Polyclonal Antibody
BT-AP02987-02 50 µL

EP-CAM Polyclonal Antibody

Sign In for Pricing
View Details
EP-CAM Polyclonal Antibody
BT-AP02987-03 100 µL

EP-CAM Polyclonal Antibody

Sign In for Pricing
View Details
NR0B1 (Nuclear Receptor Subfamily 0 Group B Member 1, Nuclear Receptor DAX-1, DSS-AHC Critical Region On The X Chromosome Protein 1, DAX1, AHC, DAX1) (MaxLight 650)
130524-ML650 100 µL

NR0B1 (Nuclear Receptor Subfamily 0 Group B Member 1, Nuclear Receptor DAX-1, DSS-AHC Critical Region On The X Chromosome Protein 1, DAX1, AHC, DAX1) (MaxLight 650)

Sign In for Pricing
View Details
Histidase (HAL) (NM_002108) Human Over-expression Lysate
LS003034-20ug 20 µg

Histidase (HAL) (NM_002108) Human Over-expression Lysate

Sign In for Pricing
View Details
Myostatin inhibitory peptide 7
orb3142765-01 50 mg

Myostatin inhibitory peptide 7

Sign In for Pricing
View Details