Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat High affinity copper uptake protein 1 (Slc31a1)

This Recombinant Rat High affinity copper uptake protein 1 (Slc31a1) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

High affinity copper uptake protein 1, Copper transporter 1, rCTR1, Liver regeneration-related protein LRRGT00200, Solute carrier family 31 member 1

UniProt

Q9JK41

Expression Region

1-187

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRMNHMEMHHMGMNHTDDNITMPPHQHPTTSASHSHEMMMPMTFYFGFKNVDLLFSSLVI NTPGEMAGAFVAVFLLAMFYEGLKIAREGLLRKSQVSIRYNSMPVPGPNGTILMETHKTV GQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVV DITEHCH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGS1 (CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase, Mitochondrial, Phosphatidylglycerophosphate Synthase 1) (MaxLight 650)
138217-ML650 100 µL

PGS1 (CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase, Mitochondrial, Phosphatidylglycerophosphate Synthase 1) (MaxLight 650)

Sign In for Pricing
View Details
Olfr17 Mouse qPCR Primer Pair (NM_020598)
MP209717 200 Reactions

Olfr17 Mouse qPCR Primer Pair (NM_020598)

Sign In for Pricing
View Details
Tau Polyclonal Antibody, Cy5 Conjugated
bs-20444R-Cy5 100 µL

Tau Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
SBNO1 ORF Vector (Human) (pORF)
ORF014370 1.0 µg DNA

SBNO1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Human LGALS8 Protein, Untagged, E.coli-1mg
QP10768-1mg 1mg

Recombinant Human LGALS8 Protein, Untagged, E.coli-1mg

Sign In for Pricing
View Details
SARS-CoV-2 Spike S1 Recombinant Protein
OPMA04853-1MG 1 mg

SARS-CoV-2 Spike S1 Recombinant Protein

Sign In for Pricing
View Details