Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

Q9MUN8

Expression Region

1-187

Origin

Mesostigma viride

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINFSTNSDLILRESVVGSRRISNYWWASVVLLGASGFLIVGISSYLQYDLVPFLSAKNI VFVPQGLVMCFYGSAGILLSIYLWLTIFWNVGEGYNEFDKVNGLVRIFRWGYPGKDRRIN IVYDIKDIQAIRVEIKEGINPRRVIYLKIKGTRDMPLTRIGQPLTLAEIEEQAARLARFL QVNIEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LCOR Knockout HEK293T Polyclonal Cells
ARG3396 1 Million

LCOR Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
Hspb1 sgRNA CRISPR Lentivector set (Mouse)
K3804801 3x 1.0 µg

Hspb1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Human Angiopoietin-1 (ANGPT1) CLIA Kit
abx195109-01 96 Tests

Human Angiopoietin-1 (ANGPT1) CLIA Kit

Sign In for Pricing
View Details
Human Angiopoietin-1 (ANGPT1) CLIA Kit
abx195109-02 5x 96 Tests

Human Angiopoietin-1 (ANGPT1) CLIA Kit

Sign In for Pricing
View Details
Human Angiopoietin-1 (ANGPT1) CLIA Kit
abx195109-03 10x 96 Tests

Human Angiopoietin-1 (ANGPT1) CLIA Kit

Sign In for Pricing
View Details
4-Bromo-2-fluorobenzaldoxime
sc-261755 1 g

4-Bromo-2-fluorobenzaldoxime

Sign In for Pricing
View Details