Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial import inner membrane translocase subunit TIM22 (TIM22)

This Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial import inner membrane translocase subunit TIM22 (TIM22) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit TIM22

UniProt

P0CR89

Expression Region

1-187

Origin

Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) (Filobasidiella neoformans)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIPLPSAMPLLPPIYLPGQEPLPAGTSDWERQEMQTALKYQRYMGMVMESCPLKVTIAG VGGLAIGGFFSLMSATFAYEDPLSRASNKLTTTRAQTMFVFKEMGRNMWSSGRGFAKVGM VYSGVECCIEGYRAKNDIYNGVSAGFLTGAILARNAGPTAMLGGGVAFAAFSGAIDWWLR SAPADEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB10 Antibody
orb1270737 400 μl

ZBTB10 Antibody

Sign In for Pricing
View Details
5-Octanoylsalicylic acid
FO153123 500 g

5-Octanoylsalicylic acid

Sign In for Pricing
View Details
N, N’-Dimethylformamide Dimethyl Acetal 96% For Synthesis
103900500 500 mL

N, N’-Dimethylformamide Dimethyl Acetal 96% For Synthesis

Sign In for Pricing
View Details
KRTAP20-4 ORF Vector (Human) (pORF)
26161011 1.0 µg DNA

KRTAP20-4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
CORO1A Peptide
MBS3226959-01 0.1 mg

CORO1A Peptide

Sign In for Pricing
View Details
CORO1A Peptide
MBS3226959-02 5x 0.1 mg

CORO1A Peptide

Sign In for Pricing
View Details