Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial import inner membrane translocase subunit TIM22 (TIM22)

This Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial import inner membrane translocase subunit TIM22 (TIM22) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit TIM22

UniProt

P0CR88

Expression Region

1-187

Origin

Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (Filobasidiella neoformans)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIPLPSAMPLLPPIYLPGQEPLPAGTSDWERQEMQTALKYQRYMGMVMESCPLKVTIAG VGGLAIGGFFSLMSATFAYEDPLSRASNKLTTTRAQTMFVFKEMGRNMWSSGRGFAKVGM VYSGVECCIEGYRAKNDIYNGVSAGFLTGAILARNAGPTAMLGGGVAFAAFSGAIDWWLR SAPADEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMPCA (B-8) Alexa Fluor® 790
sc-390471 AF790 200 µg/mL

PMPCA (B-8) Alexa Fluor® 790

Sign In for Pricing
View Details
Phenylacetylglutamine-d5
C04337-1mg 1 mg

Phenylacetylglutamine-d5

Sign In for Pricing
View Details
Recombinant Shigella Dysenteriae iraM Protein (aa 1-107)
VAng-Lsx06946-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Dysenteriae iraM Protein (aa 1-107)

Sign In for Pricing
View Details
Spermine Synthase discontinued
514508 100 µg

Spermine Synthase discontinued

Sign In for Pricing
View Details
Dactolisib (Tosylate)
HY-15174-01 50 mg

Dactolisib (Tosylate)

Sign In for Pricing
View Details
Dactolisib (Tosylate)
HY-15174-02 10 mM - 1 mL

Dactolisib (Tosylate)

Sign In for Pricing
View Details